powered by:
Protein Alignment CG32640 and dnajc5ab
DIOPT Version :9
Sequence 1: | NP_727674.1 |
Gene: | CG32640 / 318135 |
FlyBaseID: | FBgn0052640 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001338363.1 |
Gene: | dnajc5ab / 797907 |
ZFINID: | ZDB-GENE-081021-2 |
Length: | 199 |
Species: | Danio rerio |
Alignment Length: | 64 |
Identity: | 27/64 - (42%) |
Similarity: | 44/64 - (68%) |
Gaps: | 1/64 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKN-KHPRTTAQFRKINEAFNVLSDASARRKYD 65
|..|::|||:.|...|:|:::|:::||.:||||| .:|....:|::||.|..:|||.:.|..||
Zfish 15 ESLYVVLGVEKNTAQEDIKKSYRKLALKFHPDKNPNNPEAADKFKEINNAHAILSDPTKRNIYD 78
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.