DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and Dnajc18

DIOPT Version :10

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_083945.1 Gene:Dnajc18 / 76594 MGIID:1923844 Length:357 Species:Mus musculus


Alignment Length:116 Identity:42/116 - (36%)
Similarity:60/116 - (51%) Gaps:19/116 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYDA-- 66
            :||.||||.|||:|||:::|||::||.:|||||..|..|..|:.|..||.|||:...|.:||.  
Mouse    82 NYYDILGVSHNASDEELKKAYKKLALKFHPDKNCAPGATEAFKAIGNAFAVLSNPDKRLRYDEYG 146

  Fly    67 ------SVMLSRRAHTTNNSHNS-----------GGYQPNGSYEREMKTSD 100
                  :|..:|..|...:....           ||:.|:|:.......:|
Mouse   147 DEQVTFTVPRARSYHYYKDFEADISPEELFNVFFGGHFPSGNIHMFSNVTD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 PRK14299 3..>127 CDD:237667 42/116 (36%)
DnaJ 4..65 CDD:395170 32/60 (53%)
Dnajc18NP_083945.1 PRK14298 81..>182 CDD:184612 37/99 (37%)
DUF1977 249..347 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.