DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and Dnajc3

DIOPT Version :9

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_071568.1 Gene:Dnajc3 / 63880 RGDID:708518 Length:504 Species:Rattus norvegicus


Alignment Length:68 Identity:29/68 - (42%)
Similarity:41/68 - (60%) Gaps:4/68 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHPD----KNKHPRTTAQFRKINEAFNVLSDASARR 62
            :.|||.||||..||..:||.:||:::||.:|||    :.:..:...:|..|..|..||||...||
  Rat   392 KRDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQSEEEKKKAEKKFIDIAAAKEVLSDPEMRR 456

  Fly    63 KYD 65
            |:|
  Rat   457 KFD 459

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 DnaJ 4..65 CDD:278647 28/64 (44%)
Dnajc3NP_071568.1 TPR_11 36..100 CDD:290150
TPR 1 37..70
TPR repeat 37..65 CDD:276809
TPR repeat 70..100 CDD:276809
TPR 2 72..104
TPR_11 73..136 CDD:290150
TPR 3 105..138
TPR repeat 105..133 CDD:276809
TPR_1 107..137 CDD:278916
TPR_11 153..217 CDD:290150
TPR 4 154..187
TPR repeat 157..182 CDD:276809
TPR_11 187..252 CDD:290150
TPR repeat 187..217 CDD:276809
TPR 5 188..221
TPR 6 222..255
TPR repeat 222..250 CDD:276809
TPR repeat 256..296 CDD:276809
TPR 7 268..301
TPR repeat 301..335 CDD:276809
TPR 8 306..339
TPR 9 340..373
TPR repeat 340..368 CDD:276809
TPR repeat 374..397 CDD:276809 2/4 (50%)