DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and dnajb9a

DIOPT Version :9

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001020355.1 Gene:dnajb9a / 574005 ZFINID:ZDB-GENE-050626-115 Length:218 Species:Danio rerio


Alignment Length:85 Identity:38/85 - (44%)
Similarity:55/85 - (64%) Gaps:8/85 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYDAS 67
            :|||.||||..:|::.:|::|:.::|:.|||||||.|....:||:|.||:..|||...||:||  
Zfish    25 KDYYDILGVPKDASERQIKKAFHKLAMKYHPDKNKSPDAENKFREIAEAYETLSDEKRRREYD-- 87

  Fly    68 VMLSRRAHT--TNNSHNSGG 85
                |..|:  ||:..|.||
Zfish    88 ----RLGHSAFTNDDTNGGG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 DnaJ 4..65 CDD:278647 29/60 (48%)
dnajb9aNP_001020355.1 DnaJ 26..87 CDD:278647 29/60 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579365
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.