DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32640 and Dnaja2

DIOPT Version :9

Sequence 1:	NP_727674.1	Gene:	CG32640 / 318135	FlyBaseID:	FBgn0052640	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	NP_062768.1	Gene:	Dnaja2 / 56445	MGIID:	1931882	Length:	412	Species:	Mus musculus

Alignment Length:	113	Identity:	40/113 - (35%)
Similarity:	57/113 - (50%)	Gaps:	21/113 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 YMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYDASVML 70
            |.||||...|::.|:::||:::|..||||||  |....:|::|:.|:.|||:...|..||
Mouse    10 YDILGVPPGASENELKKAYRKLAKEYHPDKN--PNAGDKFKEISFAYEVLSNPEKRELYD----- 67

  Fly    71 SRRAHTTNNSHNSGGYQPNGSYEREMKTSDTFSTVCAVGGVLVGLFLG 118
              |.........|||   .|..:      |.||.:  .||.|.| |:|
Mouse    68 --RYGEQGLREGSGG---GGGMD------DIFSHI--FGGGLFG-FMG 101

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32640	NP_727674.1	DnaJ	4..65	CDD:278647	24/58 (41%)
Dnaja2	NP_062768.1	PTZ00037	4..412	CDD:240236	40/113 (35%)
		CXXCXGXG motif	143..150
		CXXCXGXG motif	159..166
		CXXCXGXG motif	186..193
		CXXCXGXG motif	202..209
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	365..412
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	1	1.000