powered by:
Protein Alignment CG32640 and DNAJC11
DIOPT Version :9
Sequence 1: | NP_727674.1 |
Gene: | CG32640 / 318135 |
FlyBaseID: | FBgn0052640 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_060668.2 |
Gene: | DNAJC11 / 55735 |
HGNCID: | 25570 |
Length: | 559 |
Species: | Homo sapiens |
Alignment Length: | 67 |
Identity: | 28/67 - (41%) |
Similarity: | 43/67 - (64%) |
Gaps: | 4/67 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQ----FRKINEAFNVLSDASARRK 63
||||.:|.|...|:.||::.||:|:.::|||||::.|...:| |..:::|:.||||...|..
Human 13 EDYYSLLNVRREASSEELKAAYRRLCMLYHPDKHRDPELKSQAERLFNLVHQAYEVLSDPQTRAI 77
Fly 64 YD 65
||
Human 78 YD 79
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32640 | NP_727674.1 |
DnaJ |
4..65 |
CDD:278647 |
25/64 (39%) |
DNAJC11 | NP_060668.2 |
DnaJ |
14..79 |
CDD:278647 |
25/64 (39%) |
DUF3395 |
417..549 |
CDD:288708 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.