powered by:
Protein Alignment CG32640 and DNAJC25
DIOPT Version :9
Sequence 1: | NP_727674.1 |
Gene: | CG32640 / 318135 |
FlyBaseID: | FBgn0052640 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001015882.2 |
Gene: | DNAJC25 / 548645 |
HGNCID: | 34187 |
Length: | 360 |
Species: | Homo sapiens |
Alignment Length: | 73 |
Identity: | 26/73 - (35%) |
Similarity: | 37/73 - (50%) |
Gaps: | 11/73 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DYYMILGVDHNATDEEIRRAYKRMALIYHPDK------NKHPRTTAQ-----FRKINEAFNVLSD 57
|.|.:|||..:|...||.|||:::|..||||: ::.|..|.| |..:..|:..|.|
Human 49 DCYEVLGVSRSAGKAEIARAYRQLARRYHPDRYRPQPGDEGPGRTPQSAEEAFLLVATAYETLKD 113
Fly 58 ASARRKYD 65
...|:.||
Human 114 EETRKDYD 121
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32640 | NP_727674.1 |
DnaJ |
4..65 |
CDD:278647 |
24/71 (34%) |
DNAJC25 | NP_001015882.2 |
DnaJ |
48..>121 |
CDD:223560 |
24/71 (34%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.