DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and Dnajb8

DIOPT Version :9

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001102718.1 Gene:Dnajb8 / 500253 RGDID:1561981 Length:230 Species:Rattus norvegicus


Alignment Length:139 Identity:47/139 - (33%)
Similarity:72/139 - (51%) Gaps:18/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQ--FRKINEAFNVLSDASARRKYDA 66
            :||.:|||..:|:.|:|::||:::||.:|||||...:..|:  |::::||:.||||:..|..||.
  Rat     3 NYYEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKQVSEAYEVLSDSKKRSVYDR 67

  Fly    67 SVMLSRRAHTTNNSHNSG----GY---QPNGSYEREMKTSDTFS-----TVCAVGG---VLVGLF 116
            :.....||....:..::|    ||   .|...:.......|.||     |..:..|   .|.|.|
  Rat    68 AGCDGWRAGGGASVPHAGPFGAGYPFRNPEDIFREFFGGLDPFSFEFWDTPFSDRGRPHGLRGAF 132

  Fly   117 -LGFGAFKA 124
             .|||.|.|
  Rat   133 SSGFGEFPA 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 DnaJ 4..65 CDD:278647 26/62 (42%)
Dnajb8NP_001102718.1 DnaJ 3..66 CDD:278647 26/62 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.