powered by:
Protein Alignment CG32640 and dnajb4
DIOPT Version :9
Sequence 1: | NP_727674.1 |
Gene: | CG32640 / 318135 |
FlyBaseID: | FBgn0052640 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001003455.1 |
Gene: | dnajb4 / 445061 |
ZFINID: | ZDB-GENE-040801-192 |
Length: | 340 |
Species: | Danio rerio |
Alignment Length: | 65 |
Identity: | 30/65 - (46%) |
Similarity: | 45/65 - (69%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MEEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYD 65
|.:|||.|||:...|:|::|::||::.||.:||||||......:|:::.||:.||||...|..||
Zfish 1 MGKDYYKILGITKGASDDDIKKAYRKQALKWHPDKNKAANAEEKFKEVAEAYEVLSDPKKREIYD 65
Fly 66 65
Zfish 66 65
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.