DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and DNAJB9

DIOPT Version :9

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_036460.1 Gene:DNAJB9 / 4189 HGNCID:6968 Length:223 Species:Homo sapiens


Alignment Length:129 Identity:45/129 - (34%)
Similarity:66/129 - (51%) Gaps:23/129 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYDAS 67
            :.||.||||..:|::.:|::|:.::|:.|||||||.|...|:||:|.||:..||||:.|::||. 
Human    25 KSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDT- 88

  Fly    68 VMLSRRAHTTNNSHNSGGYQPNGSYEREMKTSDTFSTVCAVGGVLVGLFLGFGAFKALSGSNNN 131
              |...|.|:.......|    .|:|:....:            ...||..||.|    |.|.|
Human    89 --LGHSAFTSGKGQRGSG----SSFEQSFNFN------------FDDLFKDFGFF----GQNQN 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 DnaJ 4..65 CDD:278647 29/60 (48%)
DNAJB9NP_036460.1 type 2 signal-anchor for ER localization 7..23
DnaJ 26..>136 CDD:333066 45/128 (35%)
Divergent targeting domain. /evidence=ECO:0000250|UniProtKB:Q9QYI6 91..223 13/60 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145879
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.