DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and CG8476

DIOPT Version :9

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_731777.1 Gene:CG8476 / 41624 FlyBaseID:FBgn0038127 Length:242 Species:Drosophila melanogaster


Alignment Length:118 Identity:33/118 - (27%)
Similarity:58/118 - (49%) Gaps:2/118 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYDAS 67
            |::|.:|.|...::|.||:||:..::..||||.|...|.:..|.||.||:..|...::|:.||:.
  Fly    36 ENHYQVLNVPVGSSDREIKRAFIELSKKYHPDANSQTRDSEVFMKICEAYQTLHRVNSRQIYDSR 100

  Fly    68 VMLSRRAHTTNNSHNSGG--YQPNGSYEREMKTSDTFSTVCAVGGVLVGLFLG 118
            :.:..:..:...|..:|.  |.....|:..:::..........|||...:|.|
  Fly   101 LRMQNQNKSPQESTFTGRRVYTVWSQYQSAVRSKQMGRGSRRFGGVKPTIFKG 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 DnaJ 4..65 CDD:278647 21/60 (35%)
CG8476NP_731777.1 DnaJ 37..98 CDD:278647 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.