DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32640 and dnajc7

DIOPT Version :9

Sequence 1:	NP_727674.1	Gene:	CG32640 / 318135	FlyBaseID:	FBgn0052640	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	XP_009297610.1	Gene:	dnajc7 / 406579	ZFINID:	ZDB-GENE-040426-2483	Length:	522	Species:	Danio rerio

Alignment Length:	70	Identity:	30/70 - (42%)
Similarity:	48/70 - (68%)	Gaps:	6/70 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQ------FRKINEAFNVLSDASAR 61
            :|||.:||||.|||::||::||::.||::|||::.......|      |:::.|||.||||...:
Zfish   409 KDYYKVLGVDKNATEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTVLSDPKKK 473

  Fly    62 RKYDA 66
            .:||:
Zfish   474 TRYDS 478

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32640	NP_727674.1	DnaJ	4..65	CDD:278647	28/66 (42%)
dnajc7	XP_009297610.1	TPR_11	56..121	CDD:290150
		TPR	57..90	CDD:197478
		TPR repeat	57..85	CDD:276809
		TPR_17	79..112	CDD:290167
		TPR repeat	90..120	CDD:276809
		TPR repeat	125..153	CDD:276809
		TPR repeat	174..199	CDD:276809
		TPR repeat	210..233	CDD:276809
		TPR repeat	238..268	CDD:276809
		TPR_11	286..354	CDD:290150
		TPR repeat	286..313	CDD:276809
		TPR repeat	318..352	CDD:276809
		TPR_1	323..356	CDD:278916
		TPR repeat	357..385	CDD:276809
		DnaJ	409..>497	CDD:223560	30/70 (43%)
		DnaJ	410..477	CDD:278647	28/66 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910