DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and DnaJ-1

DIOPT Version :9

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster


Alignment Length:152 Identity:49/152 - (32%)
Similarity:70/152 - (46%) Gaps:43/152 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYD 65
            |.:|:|.|||::..|:|:||::||:::||.|||||||.|:...:|::|.||:.||||...|..:|
  Fly     1 MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFD 65

  Fly    66 ASVMLSRRAHTTNNSHN---------SGGYQPNGSYEREMK------------TSDTFSTVCAVG 109
                        |...:         .||.|| |:|..:..            :||.|      |
  Fly    66 ------------NYGEDGLKGGQPGPDGGGQP-GAYTYQFHGDPRATFAQFFGSSDPF------G 111

  Fly   110 GVLVGLFLGFGAFKALSGSNNN 131
            ....|   |...|....|.|.|
  Fly   112 AFFTG---GDNMFSGGQGGNTN 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 DnaJ 4..65 CDD:278647 30/60 (50%)
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 49/152 (32%)
DnaJ 4..65 CDD:278647 30/60 (50%)
DnaJ_C 157..320 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458997
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.