DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and DnaJ-1

DIOPT Version :10

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster


Alignment Length:152 Identity:49/152 - (32%)
Similarity:70/152 - (46%) Gaps:43/152 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYD 65
            |.:|:|.|||::..|:|:||::||:::||.|||||||.|:...:|::|.||:.||||...|..:|
  Fly     1 MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFD 65

  Fly    66 ASVMLSRRAHTTNNSHN---------SGGYQPNGSYEREMK------------TSDTFSTVCAVG 109
                        |...:         .||.|| |:|..:..            :||.|      |
  Fly    66 ------------NYGEDGLKGGQPGPDGGGQP-GAYTYQFHGDPRATFAQFFGSSDPF------G 111

  Fly   110 GVLVGLFLGFGAFKALSGSNNN 131
            ....|   |...|....|.|.|
  Fly   112 AFFTG---GDNMFSGGQGGNTN 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 PRK14299 3..>127 CDD:237667 45/144 (31%)
DnaJ 4..65 CDD:395170 30/60 (50%)
DnaJ-1NP_523936.2 DnaJ_bact 4..332 CDD:274090 48/149 (32%)

Return to query results.
Submit another query.