DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and CG12020

DIOPT Version :9

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster


Alignment Length:122 Identity:33/122 - (27%)
Similarity:45/122 - (36%) Gaps:45/122 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNK----------------------HPRTTAQ 44
            |.|||.:|.....||.|:|..||:|:|:...|.::|                      .||   |
  Fly     5 ELDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPR---Q 66

  Fly    45 FRKINEAFNVLSDASARRKYD--------ASVMLSRRAHTTNNSHNSGGYQPNGSYE 93
            :..:|.||:||.:...|..||        ..|||            ..||.|...|:
  Fly    67 WAYVNMAFDVLGNDLYRAIYDRFGEAGLFEGVML------------PNGYFPPYQYD 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 DnaJ 4..65 CDD:278647 23/82 (28%)
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 32/120 (27%)
DnaJ 7..87 CDD:278647 23/82 (28%)
DnaJ_C 156..335 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459003
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.