DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and CG12020

DIOPT Version :10

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster


Alignment Length:122 Identity:33/122 - (27%)
Similarity:45/122 - (36%) Gaps:45/122 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNK----------------------HPRTTAQ 44
            |.|||.:|.....||.|:|..||:|:|:...|.::|                      .||   |
  Fly     5 ELDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPR---Q 66

  Fly    45 FRKINEAFNVLSDASARRKYD--------ASVMLSRRAHTTNNSHNSGGYQPNGSYE 93
            :..:|.||:||.:...|..||        ..|||            ..||.|...|:
  Fly    67 WAYVNMAFDVLGNDLYRAIYDRFGEAGLFEGVML------------PNGYFPPYQYD 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 PRK14299 3..>127 CDD:237667 32/121 (26%)
DnaJ 4..65 CDD:395170 23/82 (28%)
CG12020NP_647662.1 PRK14289 7..299 CDD:237660 32/120 (27%)
DnaJ_C 156..335 CDD:199909
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.