DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and mrj

DIOPT Version :9

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster


Alignment Length:102 Identity:42/102 - (41%)
Similarity:63/102 - (61%) Gaps:10/102 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKH--PRTTAQFRKINEAFNVLSDASARRKYDA 66
            |||.||.|..:|||.|:::||:::||.:|||||..  .....:||:::||:.|||||..||.|||
  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67

  Fly    67 SVMLSRRAHTTNNSHNS--------GGYQPNGSYERE 95
            ...|.:.:::.::|.||        ||...:.||.|:
  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRD 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 DnaJ 4..65 CDD:278647 30/62 (48%)
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 30/62 (48%)
DnaJ 3..66 CDD:278647 30/62 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458992
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X251
43.740

Return to query results.
Submit another query.