DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and wus

DIOPT Version :9

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001285355.1 Gene:wus / 32683 FlyBaseID:FBgn0030805 Length:406 Species:Drosophila melanogaster


Alignment Length:66 Identity:25/66 - (37%)
Similarity:38/66 - (57%) Gaps:4/66 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQ----FRKINEAFNVLSDASARR 62
            |.:.|.:|||...|:..||..||::::..|||||.|.....||    |.:|.:|::|||...:.|
  Fly   327 ERNSYKVLGVSATASQAEITAAYRKLSKEYHPDKVKDEGLRAQAHQRFIEIQQAYSVLSKIKSNR 391

  Fly    63 K 63
            :
  Fly   392 R 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 DnaJ 4..65 CDD:278647 24/64 (38%)
wusNP_001285355.1 TM2 47..97 CDD:282945
DnaJ 327..>385 CDD:223560 22/57 (39%)
DnaJ 331..385 CDD:278647 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.