| Sequence 1: | NP_727674.1 | Gene: | CG32640 / 318135 | FlyBaseID: | FBgn0052640 | Length: | 132 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_594337.1 | Gene: | SPOM_SPAC4H3.01 / 2543672 | PomBaseID: | SPAC4H3.01 | Length: | 392 | Species: | Schizosaccharomyces pombe |
| Alignment Length: | 67 | Identity: | 28/67 - (41%) |
|---|---|---|---|
| Similarity: | 48/67 - (71%) | Gaps: | 2/67 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MEEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKN-KHPR-TTAQFRKINEAFNVLSDASARRK 63
Fly 64 YD 65 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG32640 | NP_727674.1 | PRK14299 | 3..>127 | CDD:237667 | 28/65 (43%) |
| DnaJ | 4..65 | CDD:395170 | 26/62 (42%) | ||
| SPOM_SPAC4H3.01 | NP_594337.1 | PRK10767 | 9..>97 | CDD:236757 | 28/63 (44%) |
| DnaJ-X | 173..373 | CDD:433858 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||