DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and dph4

DIOPT Version :9

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_594366.1 Gene:dph4 / 2543534 PomBaseID:SPAC926.05c Length:139 Species:Schizosaccharomyces pombe


Alignment Length:104 Identity:30/104 - (28%)
Similarity:48/104 - (46%) Gaps:21/104 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYMILGVDHNA--TDEEIRRAYKRMALIYHPDKNKH-PRTTAQFRKINEAFNVLSDASARRKYD 65
            ::|.:|.:....  ||:||:.||::..|::||||.|. |.......::.||:.|||....|::|.
pombe     2 NHYSVLNLKDGKTYTDDEIKEAYRKALLLFHPDKCKEKPSVVYTIDQVKEAYQVLSSEKDRQQYQ 66

  Fly    66 -----------ASVMLSRRAHTTNNSH-------NSGGY 86
                       :.|.||......|.|:       :.|||
pombe    67 IKQEEESSHYYSIVDLSEFEELDNGSYYYPCRCGDLGGY 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 DnaJ 4..65 CDD:278647 21/63 (33%)
dph4NP_594366.1 CbpA 1..>139 CDD:225124 30/104 (29%)
DnaJ 2..65 CDD:278647 21/62 (34%)
zf-CSL 78..133 CDD:282991 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.