Protein Alignment CG32640 and Dnajb6

DIOPT Version :9

• Sequence 1: NP_727674.1
• Gene: CG32640 / 318135
• FlyBaseID: FBgn0052640
• Length: 132
• Species: Drosophila melanogaster
• Sequence 2: NP_001365764.1
• Gene: Dnajb6 / 23950
• MGIID: 1344381
• Length: 372
• Species: Mus musculus
• Alignment Length: 64
• Identity: 30/64 - (46%)
• Similarity: 45/64 - (70%)
• Gaps: 2/64 - (3%)

  Fly     4 DYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQ--FRKINEAFNVLSDASARRKYD 65
            |||.:|||..:|:.|:|::||::.||.:|||||...:..|:  |:::.||:.|||||..|..||
Mouse     3 DYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYD 66

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
CG32640	NP_727674.1	DnaJ	4..65	CDD:278647	28/62 (45%)
Dnajb6	NP_001365764.1	Interaction with HSP70. /evidence=ECO:0000250	1..147		30/64 (47%)
		DnaJ	2..>138	CDD:223560	30/64 (47%)
		Interaction with KRT18. /evidence=ECO:0000250	120..235

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0714
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X251
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	4	3.810