DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and dnj-26

DIOPT Version :9

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_502326.1 Gene:dnj-26 / 178171 WormBaseID:WBGene00001044 Length:365 Species:Caenorhabditis elegans


Alignment Length:136 Identity:37/136 - (27%)
Similarity:58/136 - (42%) Gaps:39/136 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYD-- 65
            :|:|.||.||..|:.:|||.|:::.....||||.|||..|...:.:|.||::|.|.:.||:||  
 Worm    26 KDFYKILNVDKKASPDEIRIAFRKRIREVHPDKCKHPSATEASKVVNNAFSLLMDPAKRRQYDLQ 90

  Fly    66 ----ASVMLSRRAHTTNN---------------------------------SHNSGGYQPNGSYE 93
                ::..|.:|.:...|                                 .|||..:|.|....
 Worm    91 NAETSNENLYKRCNRNKNQRKQEYSNTQRQNHKKSEPSNGKRNEQNSSFKQDHNSKNHQSNHQKT 155

  Fly    94 REMKTS 99
            :..|::
 Worm   156 KNKKSN 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 DnaJ 4..65 CDD:278647 26/60 (43%)
dnj-26NP_502326.1 DnaJ 27..88 CDD:365959 26/60 (43%)
DUF4887 <81..174 CDD:374444 13/81 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.