DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and dnj-17

DIOPT Version :10

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_499759.2 Gene:dnj-17 / 176761 WormBaseID:WBGene00001035 Length:485 Species:Caenorhabditis elegans


Alignment Length:106 Identity:33/106 - (31%)
Similarity:55/106 - (51%) Gaps:5/106 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYMILGVDHNATDEEIRRAYKRMALIYHPDKN--KHPRTTAQFRKINEAFNVLSDASARRKYD-- 65
            :|.:|.|:.:|.|::|::.|:::||.:|||||  :....|.|||.:..|::||||...|..||  
 Worm     4 HYEVLEVERDADDDKIKKNYRKLALKWHPDKNPDRIEECTQQFRLLQAAYDVLSDPREREFYDRH 68

  Fly    66 -ASVMLSRRAHTTNNSHNSGGYQPNGSYEREMKTSDTFSTV 105
             .|::..:.......|.:...|.....|:......:.|.||
 Worm    69 RESILKGKNTDFEEQSTDLFPYFTASCYQGYENDKNGFFTV 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 PRK14299 3..>127 CDD:237667 33/106 (31%)
DnaJ 4..65 CDD:395170 24/61 (39%)
dnj-17NP_499759.2 DnaJ 3..66 CDD:395170 24/61 (39%)
ZUO1 4..>275 CDD:227594 33/106 (31%)
zf-C2H2_jaz 292..315 CDD:432381
C2H2 Zn finger 293..315 CDD:275371
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.