DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and dnj-16

DIOPT Version :10

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001254890.1 Gene:dnj-16 / 175540 WormBaseID:WBGene00001034 Length:395 Species:Caenorhabditis elegans


Alignment Length:67 Identity:30/67 - (44%)
Similarity:49/67 - (73%) Gaps:1/67 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKH-PRTTAQFRKINEAFNVLSDASARRKYD 65
            |.|:|.:|||:..|::.||:.||:::||.||||:|.: .....:|:|::.|::||||.:.||:||
 Worm    32 EMDFYQLLGVEKMASEAEIKSAYRKLALKYHPDRNPNDAHAQEEFKKVSIAYSVLSDPNKRRQYD 96

  Fly    66 AS 67
            .|
 Worm    97 VS 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 PRK14299 3..>127 CDD:237667 29/66 (44%)
DnaJ 4..65 CDD:395170 26/61 (43%)
dnj-16NP_001254890.1 PRK14297 34..>126 CDD:184611 29/65 (45%)
PLN02281 297..>370 CDD:177920
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.