DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32638 and agtrap

DIOPT Version :9

Sequence 1:NP_727668.2 Gene:CG32638 / 318133 FlyBaseID:FBgn0052638 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001188274.1 Gene:agtrap / 793937 ZFINID:ZDB-GENE-050309-11 Length:170 Species:Danio rerio


Alignment Length:164 Identity:50/164 - (30%)
Similarity:75/164 - (45%) Gaps:32/164 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MGSPFVRVKLVAFVHFFFISNAMLGSWGHGAYEFYNFLFLIAMFWSMHSKDSVEAIQTALVINAS 72
            |..|.:.:|.:..||:.....|.|.||...:|...||..|....|::..:||::|:...|:..|.
Zfish     1 MEIPAINLKAILLVHWILTVWACLLSWLPASYVLGNFSVLAVGVWAIAQRDSIDAVLLFLIGLAV 65

  Fly    73 SIFFDIVSISLHFGIMNGWAVA-----------------FSIINLILRPVSVALLYKEFNTRGGT 120
            :|..|||    ||||.  :|.|                 .:|::|:|:|||...:|:.:..|||.
Zfish    66 TILTDIV----HFGIY--YAAAELLYERSTRDLFRFSGGMAILSLLLKPVSCFFVYQMYRERGGE 124

  Fly   121 LPTGSVFPT-SQQR-SYQDIDRPTQPTPTNSQPG 152
            ......||: |:.| :||.||.       |.|.|
Zfish   125 YNVNFGFPSISRNRDAYQSIDH-------NDQSG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32638NP_727668.2 AGTRAP 8..159 CDD:197883 50/164 (30%)
agtrapNP_001188274.1 AGTRAP 9..161 CDD:283939 48/156 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592154
Domainoid 1 1.000 56 1.000 Domainoid score I11053
eggNOG 1 0.900 - - E1_2C9HK
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I5436
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1325275at2759
OrthoFinder 1 1.000 - - FOG0008160
OrthoInspector 1 1.000 - - oto39404
orthoMCL 1 0.900 - - OOG6_109487
Panther 1 1.100 - - LDO PTHR16521
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5209
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.