DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32638 and AGTRAP

DIOPT Version :9

Sequence 1:NP_727668.2 Gene:CG32638 / 318133 FlyBaseID:FBgn0052638 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_011540102.1 Gene:AGTRAP / 57085 HGNCID:13539 Length:171 Species:Homo sapiens


Alignment Length:161 Identity:48/161 - (29%)
Similarity:79/161 - (49%) Gaps:17/161 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MGSPFVRVKLVA------FVHFFFISNAMLGSWG----HGAYEFYNFLFLIAMFWSMHSKDSVEA 62
            |..|.|.:|..:      ..|...:.:.:|.:||    .|:|.:.||..|....|::..:||::|
Human     1 MELPAVNLKCASSSVPRNHPHVILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQRDSIDA 65

  Fly    63 IQTALVINASSIFFDIVSISLHFGIMN-----GWAVAFSIINLILRPVSVALLYKEFNTRGGTLP 122
            |...|....::||.|||.||:.:..::     .:.|..:|::|:|:|:|...:|..:..|||.|.
Human    66 ISMFLGGLLATIFLDIVHISIFYPRVSLTDTGRFGVGMAILSLLLKPLSCCFVYHMYRERGGELL 130

  Fly   123 TGSVF-PTSQQRS-YQDIDRPTQPTPTNSQP 151
            ..:.| .:||.|| ||.||....|....:.|
Human   131 VHTGFLGSSQDRSAYQTIDSAEAPADPFAVP 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32638NP_727668.2 AGTRAP 8..159 CDD:197883 48/161 (30%)
AGTRAPXP_011540102.1 AGTRAP 22..164 CDD:283939 43/140 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156530
Domainoid 1 1.000 62 1.000 Domainoid score I10410
eggNOG 1 0.900 - - E1_2C9HK
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5360
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1325275at2759
OrthoFinder 1 1.000 - - FOG0008160
OrthoInspector 1 1.000 - - oto91062
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16521
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5209
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.