DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32638 and agtrap

DIOPT Version :9

Sequence 1:NP_727668.2 Gene:CG32638 / 318133 FlyBaseID:FBgn0052638 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001015751.1 Gene:agtrap / 548468 XenbaseID:XB-GENE-482876 Length:163 Species:Xenopus tropicalis


Alignment Length:157 Identity:39/157 - (24%)
Similarity:70/157 - (44%) Gaps:14/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MGSPFVRVKLVAFVHFFFISNAMLGSWGHGAYEFYNFLFLIAMFWSMHSKDSVEAIQTALVINAS 72
            |..|.|.:|.:.|.|:.....|.:..|...||...|...|....|::..:||::||...|:....
 Frog     1 MELPAVNLKAIVFTHWLLTVFACMIDWLPKAYGLANITILAMGVWAIAQRDSIDAIFMFLIGLLL 65

  Fly    73 SIFFDIVSISLHF---------GIMNG---WAVAFSIINLILRPVSVALLYKEFNTRGGT--LPT 123
            :|..||:..:|:|         |.:..   ::....|.:|:|:|:|...:|..:..|||.  :..
 Frog    66 TILTDILLFALYFTEAEKASESGPLRDLFRFSSGMGIFSLLLKPLSCFFMYHMYRERGGEYFVNL 130

  Fly   124 GSVFPTSQQRSYQDIDRPTQPTPTNSQ 150
            |.:..:..:.|||.|:....|...:::
 Frog   131 GFITLSRDRSSYQSIEHMDPPADQDNK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32638NP_727668.2 AGTRAP 8..159 CDD:197883 39/157 (25%)
agtrapNP_001015751.1 AGTRAP 1..163 CDD:197883 39/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5259
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1325275at2759
OrthoFinder 1 1.000 - - FOG0008160
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16521
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5209
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.100

Return to query results.
Submit another query.