DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32638 and Agtrap

DIOPT Version :9

Sequence 1:NP_727668.2 Gene:CG32638 / 318133 FlyBaseID:FBgn0052638 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001007655.1 Gene:Agtrap / 298646 RGDID:1359346 Length:160 Species:Rattus norvegicus


Alignment Length:148 Identity:48/148 - (32%)
Similarity:75/148 - (50%) Gaps:17/148 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MGSPFVRVKLVAFVHFFFISNAMLGSWG----HGAYEFYNFLFLIAMFWSMHSKDSVEAIQTALV 68
            |..|.|.:|::..||:      :|.:||    .|:|.:.||..|....|::..:|||:||...|.
  Rat     1 MELPAVNLKVILLVHW------LLTTWGCLAFSGSYAWGNFTILALGVWAVAQRDSVDAIGMFLG 59

  Fly    69 INASSIFFDIVSISLHF-----GIMNGWAVAFSIINLILRPVSVALLYKEFNTRGGTLPTGSVF- 127
            ...::||.||:.||:.:     |....::...:|.:|:|:|.|..|:|.....|||.||..|.| 
  Rat    60 GLVATIFLDIIYISIFYSSVAVGDTGRFSAGMAIFSLLLKPFSCCLVYHMHRERGGELPLRSDFF 124

  Fly   128 -PTSQQRSYQDIDRPTQP 144
             |:.:..:||.||....|
  Rat   125 GPSQEHSAYQTIDSSDSP 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32638NP_727668.2 AGTRAP 8..159 CDD:197883 48/148 (32%)
AgtrapNP_001007655.1 AGTRAP 1..160 CDD:197883 48/148 (32%)
Interaction with AGTR1. /evidence=ECO:0000250 110..122 5/11 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..160 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350437
Domainoid 1 1.000 68 1.000 Domainoid score I9549
eggNOG 1 0.900 - - E1_2C9HK
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5206
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1325275at2759
OrthoFinder 1 1.000 - - FOG0008160
OrthoInspector 1 1.000 - - oto98155
orthoMCL 1 0.900 - - OOG6_109487
Panther 1 1.100 - - LDO PTHR16521
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.