DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32638 and Agtrap

DIOPT Version :9

Sequence 1:NP_727668.2 Gene:CG32638 / 318133 FlyBaseID:FBgn0052638 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_033772.2 Gene:Agtrap / 11610 MGIID:1339977 Length:161 Species:Mus musculus


Alignment Length:143 Identity:44/143 - (30%)
Similarity:72/143 - (50%) Gaps:17/143 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MGSPFVRVKLVAFVHFFFISNAMLGSWG----HGAYEFYNFLFLIAMFWSMHSKDSVEAIQTALV 68
            |..|.|.:|::..||:      :|.:||    ..:|.:.||..|....|::..:||::||...|.
Mouse     1 MELPAVNLKVILLVHW------LLTTWGCLVFSSSYAWGNFTILALGVWAVAQRDSIDAIGMFLG 59

  Fly    69 INASSIFFDIVSISLHF-----GIMNGWAVAFSIINLILRPVSVALLYKEFNTRGGTLPTGSVF- 127
            ...::||.||:.||:.:     |....:....:|::|:|:|.|..|:|.....|||.||....| 
Mouse    60 GLVATIFLDIIYISIFYSSVATGDTGRFGAGMAILSLLLKPFSCCLVYHMHRERGGELPLRPDFF 124

  Fly   128 -PTSQQRSYQDID 139
             |:.:..:||.||
Mouse   125 GPSQEHSAYQTID 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32638NP_727668.2 AGTRAP 8..159 CDD:197883 44/143 (31%)
AgtrapNP_033772.2 AGTRAP 1..161 CDD:197883 44/143 (31%)
Interaction with AGTR1. /evidence=ECO:0000250 110..122 5/11 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846939
Domainoid 1 1.000 62 1.000 Domainoid score I10380
eggNOG 1 0.900 - - E1_2C9HK
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5354
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008160
OrthoInspector 1 1.000 - - oto94647
orthoMCL 1 0.900 - - OOG6_109487
Panther 1 1.100 - - LDO PTHR16521
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5209
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.