DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim1 and LMO4

DIOPT Version :10

Sequence 1:NP_572505.1 Gene:Lim1 / 31813 FlyBaseID:FBgn0026411 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_006760.1 Gene:LMO4 / 8543 HGNCID:6644 Length:165 Species:Homo sapiens


Alignment Length:160 Identity:59/160 - (36%)
Similarity:85/160 - (53%) Gaps:21/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NIGRSE--PPVGVGD----PCAGCNKPILDKFLLNVLERAWHASCVRCCECLQPLTD---KCFSR 68
            |.|.|.  |||..|.    .||||...|.|:|||..::..||:.|::|..|...|.|   .|:::
Human     3 NPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTK 67

  Fly    69 ESKLYCRNDFFRRYGTK--CSGCGQGIAPSDLVRKPRDKVFHLNCFTCCICRKQLSTGEQLYVLD 131
            ...:.||||:.|.:|..  ||.|||.|..|:||.:.:..|:||.||||..||.:|..|::.:.::
Human    68 SGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYIN 132

  Fly   132 DNKFICKDDYLLGKAPSC---GH-NSLSDS 157
            .:.| |:.|     .|:.   || |||..:
Human   133 GSLF-CEHD-----RPTALINGHLNSLQSN 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim1NP_572505.1 LIM1_Lhx1_Lhx5 27..78 CDD:188753 20/53 (38%)
LIM2_Lhx1_Lhx5 86..141 CDD:188761 22/54 (41%)
COG5576 185..324 CDD:227863
Homeodomain 248..304 CDD:459649
LMO4NP_006760.1 LIM1_LMO4 23..77 CDD:188772 20/53 (38%)
LIM2_LMO4 87..141 CDD:188773 23/59 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.