DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim1 and Nanog

DIOPT Version :9

Sequence 1:NP_572505.1 Gene:Lim1 / 31813 FlyBaseID:FBgn0026411 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_082292.1 Gene:Nanog / 71950 MGIID:1919200 Length:305 Species:Mus musculus


Alignment Length:156 Identity:30/156 - (19%)
Similarity:62/156 - (39%) Gaps:27/156 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 LGLGVLGPNGPDSAGGPLGTSDIS------------------VQSMSTDSKNTHDDSDQGSLDGD 225
            :.:|:.||:...|:.....:.:.|                  .:.:.|::.:....|:...|.|.
Mouse     1 MSVGLPGPHSLPSSEEASNSGNASSMPAVFHPENYSCLQGSATEMLCTEAASPRPSSEDLPLQGS 65

  Fly   226 PDGRGDSQAENKSPDDANG---------SKRRGPRTTIKAKQLEVLKTAFNQTPKPTRHIREQLA 281
            ||.....:.:..||:...|         ::::..||.....||..||..|.:....:....::|:
Mouse    66 PDSSTSPKQKLSSPEADKGPEEEENKVLARKQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQELS 130

  Fly   282 KETGLPMRVIQVWFQNKRSKERRMKQ 307
            ....|..:.::.||||:|.|.:|.::
Mouse   131 SILNLSYKQVKTWFQNQRMKCKRWQK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim1NP_572505.1 LIM1_Lhx1_Lhx5 27..78 CDD:188753
LIM2_Lhx1_Lhx5 86..141 CDD:188761
COG5576 185..324 CDD:227863 29/150 (19%)
Homeobox 250..303 CDD:278475 15/52 (29%)
NanogNP_082292.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 5/28 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..95 9/48 (19%)
Sufficient for interaction with SALL4. /evidence=ECO:0000269|PubMed:16840789 96..155 16/58 (28%)
HOX 96..152 CDD:197696 15/55 (27%)
Required for DNA-binding. /evidence=ECO:0000250|UniProtKB:Q9H9S0 123..152 8/28 (29%)
10 X repeats starting with a Trp in each unit 198..247
Sufficient for transactivation activity 198..247
Sufficient for strong transactivation activity 248..305
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.