DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim1 and zen2

DIOPT Version :10

Sequence 1:NP_572505.1 Gene:Lim1 / 31813 FlyBaseID:FBgn0026411 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:193 Identity:42/193 - (21%)
Similarity:63/193 - (32%) Gaps:62/193 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 NGSKRRGPRTTIKAKQLEVLKTAFNQTPKPTRHIREQLAKETGLPMRVIQVWFQNKRSKERRMKQ 307
            :..|.:..||...:.||..|:..|:......|..|.::::...|..|.:::||||     ||||.
  Fly    39 SSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQN-----RRMKL 98

  Fly   308 ITSMGRPPFFGG----------------------ARKMRGFPMNLSP--------GGLDDGPGFP 342
            ..|..|....|.                      .|.:|....|:..        |.|::|...|
  Fly    99 KKSTNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQITP 163

  Fly   343 YFAADAKFEFGYGGPFHPHDGPYFPGHPGGPMPFNAPGGPMDHSGPIPMVNEFGLTPEATFLG 405
                          |:..:|  |.  |...|.|...|..|.         |||.....:::||
  Fly   164 --------------PYQSYD--YL--HEFSPEPMALPQLPF---------NEFDANWASSWLG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim1NP_572505.1 LIM1_Lhx1_Lhx5 27..78 CDD:188753
LIM2_Lhx1_Lhx5 86..141 CDD:188761
COG5576 185..324 CDD:227863 23/102 (23%)
Homeodomain 248..304 CDD:459649 14/55 (25%)
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 18/60 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.