DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim1 and HOXC10

DIOPT Version :9

Sequence 1:NP_572505.1 Gene:Lim1 / 31813 FlyBaseID:FBgn0026411 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_059105.2 Gene:HOXC10 / 3226 HGNCID:5122 Length:342 Species:Homo sapiens


Alignment Length:187 Identity:52/187 - (27%)
Similarity:83/187 - (44%) Gaps:26/187 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 LGKAPSC-GHNSLSDSLMGSASEDDDDDDPPHLRATALGLGVLGPNGPDSAGGPLGTSDISVQSM 206
            |.|.|.| |.|.........||.:...:   ||.:..||..|..|..|.|.......::|..:..
Human   158 LDKTPHCSGANDFEAPFEQRASLNPRAE---HLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQS 219

  Fly   207 STDSKNTHDDSDQ---GSLDGDPD-----GRGDSQAENKSPD---DANGSKRRGPRTTIKAKQLE 260
            ....|.:..:|::   .:.|..||     .:.:.:|||.:.:   ..:|.|:|.|.|  |.:.||
Human   220 LAGPKGSPSESEKERAKAADSSPDTSDNEAKEEIKAENTTGNWLTAKSGRKKRCPYT--KHQTLE 282

  Fly   261 VLKT-AFNQTPKPTRHIREQLAKETGLPMRVIQVWFQNKRSK------ERRMKQITS 310
            :.|. .||.  ..||..|.:::|...|..|.:::||||:|.|      |.|::::||
Human   283 LEKEFLFNM--YLTRERRLEISKTINLTDRQVKIWFQNRRMKLKKMNRENRIRELTS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim1NP_572505.1 LIM1_Lhx1_Lhx5 27..78 CDD:188753
LIM2_Lhx1_Lhx5 86..141 CDD:188761
COG5576 185..324 CDD:227863 39/144 (27%)
Homeobox 250..303 CDD:278475 20/59 (34%)
HOXC10NP_059105.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..271 17/83 (20%)
Homeobox 271..324 CDD:306543 21/56 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.