DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim1 and hoxa10b

DIOPT Version :9

Sequence 1:NP_572505.1 Gene:Lim1 / 31813 FlyBaseID:FBgn0026411 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_571230.2 Gene:hoxa10b / 30391 ZFINID:ZDB-GENE-990415-97 Length:347 Species:Danio rerio


Alignment Length:300 Identity:73/300 - (24%)
Similarity:115/300 - (38%) Gaps:99/300 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RCCECLQP---LTDKCFS---RESKLYCRND--------------FFRRYGTKC-----SGCGQG 92
            |.|...||   :|.:.||   :|...||..:              :.|.....|     :||   
Zfish   100 RSCRIEQPNNQITPRSFSPTIKEENSYCLYESEKCPKETITEDISYSRLTPNSCPSSNNNGC--- 161

  Fly    93 IAPSDLVRKPRDKVFHLN--CFTCCICRKQLSTGEQLYVLDDNKFICKDDYLLGKAPSCGHNSLS 155
                    .|....|.|:  |.|        |.|     ..||:.|  ..:::.:..:...:|||
Zfish   162 --------VPVPGYFRLSQTCTT--------SKG-----FTDNQTI--PTHVVAQRSTRFDSSLS 203

  Fly   156 DSLMGSASEDDDDDDPPHLRATALGLG--VLGPNGPDSAGGPLGTSDISVQSMSTDSKNTHDDSD 218
             ::...||. |:.|:||.....|.|..  :.|..|..|:..|..:.:.:|    |.:|       
Zfish   204 -AIAAEASR-DESDEPPTCAPCAPGRNKELRGSTGTASSPEPPDSPEKAV----TVTK------- 255

  Fly   219 QGSLDGDPDGRGDSQAENKSPDDAN------GSKRRGPRTTIKAKQLEVLKT-AFNQTPKPTRHI 276
                      .|||    ||...||      |.|:|.|.|  |.:.||:.|. .||.  ..||..
Zfish   256 ----------AGDS----KSESTANWLTAKSGRKKRCPYT--KHQTLELEKEFLFNM--YLTRER 302

  Fly   277 REQLAKETGLPMRVIQVWFQNKR------SKERRMKQITS 310
            |.::::...|..|.:::||||:|      |:|.|::::::
Zfish   303 RLEISRSVHLTDRQVKIWFQNRRMKLKKMSRENRIRELSA 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim1NP_572505.1 LIM1_Lhx1_Lhx5 27..78 CDD:188753 10/44 (23%)
LIM2_Lhx1_Lhx5 86..141 CDD:188761 13/61 (21%)
COG5576 185..324 CDD:227863 38/138 (28%)
Homeobox 250..303 CDD:278475 19/59 (32%)
hoxa10bNP_571230.2 Homeobox 276..329 CDD:306543 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.