DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim1 and Lmo2

DIOPT Version :10

Sequence 1:NP_572505.1 Gene:Lim1 / 31813 FlyBaseID:FBgn0026411 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_032531.2 Gene:Lmo2 / 16909 MGIID:102811 Length:228 Species:Mus musculus


Alignment Length:119 Identity:36/119 - (30%)
Similarity:65/119 - (54%) Gaps:6/119 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CAGCNKPILDKFLLNVLERAWHASCVRC--CEC-LQPLTDKCFSRESKLYCRNDFFRRYGTK--C 86
            |.||.:.|.|::.|..:::.||..|:.|  |.| |..:..:.:.:..:..||.|:.|.:|..  |
Mouse   100 CGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLC 164

  Fly    87 SGCGQGIAPSDLVRKPRDKVFHLNCFTCCICRKQLSTGEQLYVLDDNKFICKDD 140
            :.|.:.|...::..:.:|||:||.||.|..|:|....|:: |:|.::..:|:.|
Mouse   165 ASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDR-YLLINSDIVCEQD 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim1NP_572505.1 LIM1_Lhx1_Lhx5 27..78 CDD:188753 15/53 (28%)
LIM2_Lhx1_Lhx5 86..141 CDD:188761 18/55 (33%)
COG5576 185..324 CDD:227863
Homeodomain 248..304 CDD:459649
Lmo2NP_032531.2 LIM1_LMO2 100..155 CDD:188770 16/54 (30%)
LIM2_LMO2 164..219 CDD:188771 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.