DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lim1 and Hoxa2

DIOPT Version :9

Sequence 1:	NP_572505.1	Gene:	Lim1 / 31813	FlyBaseID:	FBgn0026411	Length:	505	Species:	Drosophila melanogaster
Sequence 2:	NP_034581.1	Gene:	Hoxa2 / 15399	MGIID:	96174	Length:	372	Species:	Mus musculus

Alignment Length:	67	Identity:	23/67 - (34%)
Similarity:	32/67 - (47%)	Gaps:	0/67 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   241 DANGSKRRGPRTTIKAKQLEVLKTAFNQTPKPTRHIREQLAKETGLPMRVIQVWFQNKRSKERRM 305
            |.:|...|..||.....||..|:..|:......|..|.::|....|..|.::|||||:|.|.:|.
Mouse   133 DGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQ 197

  Fly   306 KQ 307
            .|
Mouse   198 TQ 199

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lim1	NP_572505.1	LIM1_Lhx1_Lhx5	27..78	CDD:188753
		LIM2_Lhx1_Lhx5	86..141	CDD:188761
		COG5576	185..324	CDD:227863	23/67 (34%)
		Homeobox	250..303	CDD:278475	18/52 (35%)
Hoxa2	NP_034581.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	48..95
		Antp-type hexapeptide	96..101
		Homeobox	143..195	CDD:278475	18/51 (35%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	194..225		2/6 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000