DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim1 and Hoxa10

DIOPT Version :9

Sequence 1:NP_572505.1 Gene:Lim1 / 31813 FlyBaseID:FBgn0026411 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_032289.2 Gene:Hoxa10 / 15395 MGIID:96171 Length:416 Species:Mus musculus


Alignment Length:290 Identity:73/290 - (25%)
Similarity:103/290 - (35%) Gaps:75/290 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 QPLTDKC-FS---RESKLYCRNDFFRRYGTKCSGCGQGIAPSDLVRKPR----DKVFHLNCFTCC 115
            ||....| |:   :|...||..|       ....|.:|.|.:||...||    |.          
Mouse   159 QPQATSCSF
AQNIKEESSYCLYD-------AADKCPKGSAAADLAPFPRGPPPDG---------- 206

  Fly   116 ICRKQLSTGEQLYVLDDNKFICKDDYLLGKAPSCGHNSLSDSLMGS---ASEDDDDDDPPHLRAT 177
             |....|:|    |.....|.....|  |.|...|........:.|   |.......|||    .
Mouse   207 -CALGASSG----VPVPGYFRLSQAY--GTAKGFGSGGGGTQQLASPFPAQPPGRGFDPP----P 260

  Fly   178 ALGLG---------VLGPNGPDS-----AGGPLGTSDISVQSMSTDSKNTHDDSDQGSLDGDPDG 228
            ||..|         ||....|.:     .||..|..:....|.:.:..:. ..|:......:.|.
Mouse   261 ALASGSTEAAGKERVLDSTPPPTLVCTGGGGSQGDEEAHASSSAAEELSP-APSENSKASPEKDS 324

  Fly   229 RGDSQAENKSPDDAN------GSKRRGPRTTIKAKQLEVLKT-AFNQTPKPTRHIREQLAKETGL 286
            .|.|:.||.    ||      |.|:|.|.|  |.:.||:.|. .||.  ..||..|.::::...|
Mouse   325 LGSSKGENA----ANWLTAKSGRKKRCPYT--KHQTLELEKEFLFNM--YLTRERRLEISRSVHL 381

  Fly   287 PMRVIQVWFQNKRSK------ERRMKQITS 310
            ..|.:::||||:|.|      |.|::::|:
Mouse   382 TDRQVKIWFQNRRMKLKKMNRENRIRELTA 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim1NP_572505.1 LIM1_Lhx1_Lhx5 27..78 CDD:188753 7/22 (32%)
LIM2_Lhx1_Lhx5 86..141 CDD:188761 13/58 (22%)
COG5576 185..324 CDD:227863 38/144 (26%)
Homeobox 250..303 CDD:278475 19/59 (32%)
Hoxa10NP_032289.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..60
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..167 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..345 27/125 (22%)
Homeobox 345..398 CDD:278475 20/56 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.