DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lim1 and Hoxa2

DIOPT Version :9

Sequence 1:NP_572505.1 Gene:Lim1 / 31813 FlyBaseID:FBgn0026411 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_036713.2 Gene:Hoxa2 / 103690123 RGDID:2813 Length:372 Species:Rattus norvegicus


Alignment Length:67 Identity:23/67 - (34%)
Similarity:32/67 - (47%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 DANGSKRRGPRTTIKAKQLEVLKTAFNQTPKPTRHIREQLAKETGLPMRVIQVWFQNKRSKERRM 305
            |.:|...|..||.....||..|:..|:......|..|.::|....|..|.::|||||:|.|.:|.
  Rat   133 DGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQ 197

  Fly   306 KQ 307
            .|
  Rat   198 TQ 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lim1NP_572505.1 LIM1_Lhx1_Lhx5 27..78 CDD:188753
LIM2_Lhx1_Lhx5 86..141 CDD:188761
COG5576 185..324 CDD:227863 23/67 (34%)
Homeobox 250..303 CDD:278475 18/52 (35%)
Hoxa2NP_036713.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..96
Antp-type hexapeptide 96..101
Homeobox 143..196 CDD:395001 18/52 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..225 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.