powered by:
Protein Alignment Lim1 and Hoxa2
DIOPT Version :9
Sequence 1: | NP_572505.1 |
Gene: | Lim1 / 31813 |
FlyBaseID: | FBgn0026411 |
Length: | 505 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_036713.2 |
Gene: | Hoxa2 / 103690123 |
RGDID: | 2813 |
Length: | 372 |
Species: | Rattus norvegicus |
Alignment Length: | 67 |
Identity: | 23/67 - (34%) |
Similarity: | 32/67 - (47%) |
Gaps: | 0/67 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 241 DANGSKRRGPRTTIKAKQLEVLKTAFNQTPKPTRHIREQLAKETGLPMRVIQVWFQNKRSKERRM 305
|.:|...|..||.....||..|:..|:......|..|.::|....|..|.::|||||:|.|.:|.
Rat 133 DGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQ 197
Fly 306 KQ 307
.|
Rat 198 TQ 199
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.