DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32625 and Gtsf2

DIOPT Version :9

Sequence 1:NP_727732.1 Gene:CG32625 / 318128 FlyBaseID:FBgn0052625 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001102758.1 Gene:Gtsf2 / 500938 RGDID:1563200 Length:154 Species:Rattus norvegicus


Alignment Length:141 Identity:36/141 - (25%)
Similarity:60/141 - (42%) Gaps:30/141 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CPNSSSHLVMLFKMPYHLPLCAKKFP--SDELARCPYNRTHMYPIADIYEHIIKC---------P 66
            ||...:|.:...::.|||..|.||.|  :.::|.|.||..|:.||..:.||...|         |
  Rat     9 CPYDPNHRIPASRLQYHLASCKKKNPKIAKKMANCKYNACHVVPIKRLKEHEANCINRTAVDDEP 73

  Fly    67 SYLREESHSDAKEDAKDCDA--KESDAKDWDAD-----PP--VSTYDP-NIHCEKNPIIRRLHGA 121
            ..|::.:....:|:...|.|  :.:|...|:.|     |.  :.|:.| .:.||.:         
  Rat    74 LNLQKITQPSFEENENLCSAGSQFTDPDVWNVDHMNHFPSFVLETFAPKTLVCESD--------- 129

  Fly   122 TRSSRRAFREK 132
            :|..:.|..:|
  Rat   130 SRDLQEAMSDK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32625NP_727732.1 zf-U11-48K 43..66 CDD:283028 10/31 (32%)
Gtsf2NP_001102758.1 zf-U11-48K 9..29 CDD:398771 6/19 (32%)
zf-U11-48K 43..63 CDD:398771 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4376
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21402
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.