DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32625 and zgc:56699

DIOPT Version :9

Sequence 1:NP_727732.1 Gene:CG32625 / 318128 FlyBaseID:FBgn0052625 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_997998.1 Gene:zgc:56699 / 405758 ZFINID:ZDB-GENE-040426-2099 Length:182 Species:Danio rerio


Alignment Length:111 Identity:29/111 - (26%)
Similarity:50/111 - (45%) Gaps:21/111 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SADPKLYEYVNCPNSSSHLVMLFKMPYHLPLCAKKFP--SDELARCPYNRTHMYPIADIYEHIIK 64
            ::||.  ..|.||...:|.:...:.|:|:..|.|..|  :.||..||:|..|:.|..::..||..
Zfish    37 ASDPN--RIVQCPYDKNHQIRASRFPFHVLKCRKNHPKLASELKTCPFNARHLIPKHEMSHHIAN 99

  Fly    65 CPSYLREESHSDAKEDAKDCDAKESDAKDWDA-DPPVSTYD---PN 106
            |             ||.:..:|::.:.:..:. ..||:|:.   ||
Zfish   100 C-------------EDKRCLNAEDGNVEVLEKFQVPVNTWTNPAPN 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32625NP_727732.1 zf-U11-48K 43..66 CDD:283028 7/22 (32%)
zgc:56699NP_997998.1 zf-U11-48K 44..67 CDD:283028 6/22 (27%)
zf-U11-48K 78..101 CDD:283028 8/35 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5406
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21402
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.