DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32625 and arx

DIOPT Version :9

Sequence 1:NP_727732.1 Gene:CG32625 / 318128 FlyBaseID:FBgn0052625 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_649071.1 Gene:arx / 40061 FlyBaseID:FBgn0036826 Length:167 Species:Drosophila melanogaster


Alignment Length:140 Identity:39/140 - (27%)
Similarity:64/140 - (45%) Gaps:24/140 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VNCPNSSSHLVMLFKMPYHLPLCAKKFPSD-ELARCPYNRTHMYPIADIYEHIIKC--------- 65
            |.||.:..|.::..|:..|:..|...:... ||..||:|.:|:.|....::|...|         
  Fly     2 VYCPYNKEHKMLRKKLQQHILKCRVIYKDTVELMVCPFNSSHLIPEPQFFQHTQSCEDRNIIVHY 66

  Fly    66 ----PSYLREESHSDAKEDAKDCDAKESDAKDWDADPPVSTYDPNIHCEKNPIIRRLHGATRSSR 126
                |:.|.|::.          .||....::||.|..|..|||.::|.:..|:|..:|...:.|
  Fly    67 QTSAPAVLSEDTR----------HAKIESEENWDDDESVPDYDPQVYCSRANIVREPNGLFPAQR 121

  Fly   127 RAFREKERKR 136
            |||.|:|::|
  Fly   122 RAFIEQEKRR 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32625NP_727732.1 zf-U11-48K 43..66 CDD:283028 7/35 (20%)
arxNP_649071.1 zf-U11-48K 4..25 CDD:283028 5/20 (25%)
zf-U11-48K 35..58 CDD:283028 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4376
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I4117
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42358
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21402
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.