powered by:
Protein Alignment CG32625 and Gtsf1l
DIOPT Version :9
Sequence 1: | NP_727732.1 |
Gene: | CG32625 / 318128 |
FlyBaseID: | FBgn0052625 |
Length: | 144 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006235686.3 |
Gene: | Gtsf1l / 366244 |
RGDID: | 1306224 |
Length: | 151 |
Species: | Rattus norvegicus |
Alignment Length: | 73 |
Identity: | 26/73 - (35%) |
Similarity: | 37/73 - (50%) |
Gaps: | 6/73 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DPKLYEYVNCPNSSSHLVMLFKMPYHLPLCAKKFP--SDELARCPYNRTHMYPIADIYEHIIKC- 65
:|:..|. ||.:..|.:.|.:..|||..|.||.| :.::|.|.||..|:.||..:.||...|
Rat 2 EPESIEI--CPYNPHHRIPLSRFQYHLASCRKKNPKKAKKMASCKYNACHVVPIRKLAEHEATCV 64
Fly 66 -PSYLREE 72
.|.:.||
Rat 65 NRSSMEEE 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1359124at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.