DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32625 and Gtsf2

DIOPT Version :9

Sequence 1:NP_727732.1 Gene:CG32625 / 318128 FlyBaseID:FBgn0052625 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_808299.1 Gene:Gtsf2 / 223927 MGIID:2652828 Length:154 Species:Mus musculus


Alignment Length:141 Identity:34/141 - (24%)
Similarity:58/141 - (41%) Gaps:30/141 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CPNSSSHLVMLFKMPYHLPLCAKKFP--SDELARCPYNRTHMYPIADIYEHIIKC---------P 66
            ||...:|.:...::.|||..|.||.|  :.::|.|.||..|:.||..:.||...|         |
Mouse     9 CPYDPNHRIPASRLQYHLASCKKKNPKIAKKMANCKYNACHVVPIKRLKEHEANCINRTAVDDEP 73

  Fly    67 SYLREESHS--DAKEDAKDCDAKESDAKDWDADPP-------VSTYDP-NIHCEKNPIIRRLHGA 121
            ..|::.:|.  :..|:.....::..|...|:.|..       :.|:.| .:.||.:         
Mouse    74 LNLQKITHPVFEENENFSSAGSQFPDPDVWNVDHAHHFPSFVLETFAPKKLVCESD--------- 129

  Fly   122 TRSSRRAFREK 132
            :|..:.|..:|
Mouse   130 SRDLQEAMADK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32625NP_727732.1 zf-U11-48K 43..66 CDD:283028 10/31 (32%)
Gtsf2NP_808299.1 zf-U11-48K 9..29 CDD:368359 6/19 (32%)
zf-U11-48K 43..63 CDD:368359 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4376
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21402
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.