DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32625 and gtsf-1

DIOPT Version :9

Sequence 1:NP_727732.1 Gene:CG32625 / 318128 FlyBaseID:FBgn0052625 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_503000.1 Gene:gtsf-1 / 178471 WormBaseID:WBGene00020286 Length:169 Species:Caenorhabditis elegans


Alignment Length:126 Identity:33/126 - (26%)
Similarity:47/126 - (37%) Gaps:36/126 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VNCPNSSSHLVMLFKMPYHLPLCAKK----FP-SDELARCPYNRTHMYPIADIYEHIIKC----- 65
            :.||.:|.|.|.:.:...||..|..:    :| |.:|.||.||..|..|..::..|.|.|     
 Worm    19 ITCPYNSDHKVSMEEFNTHLWKCRTEKLHFYPHSLKLKRCSYNMRHFLPEEELQFHEIFCKRQSA 83

  Fly    66 ---------PSYLREESHSDAKEDAKDCDAKE-----SDAKDWDADPPVSTYDPNIHCEKN 112
                     |..|....|..|::..|:.:..|     ||..|.|.:            |||
 Worm    84 DLRRQLSLEPLELNVAEHLAAQKLRKEYEKDEESLDGSDDSDEDEE------------EKN 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32625NP_727732.1 zf-U11-48K 43..66 CDD:283028 9/36 (25%)
gtsf-1NP_503000.1 zf-U11-48K 19..42 CDD:368359 7/22 (32%)
zf-U11-48K 56..79 CDD:368359 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4376
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I4117
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21402
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.930

Return to query results.
Submit another query.