DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32625 and gtsf2

DIOPT Version :9

Sequence 1:NP_727732.1 Gene:CG32625 / 318128 FlyBaseID:FBgn0052625 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001120225.1 Gene:gtsf2 / 100145274 XenbaseID:XB-GENE-5780436 Length:278 Species:Xenopus tropicalis


Alignment Length:122 Identity:36/122 - (29%)
Similarity:54/122 - (44%) Gaps:16/122 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSADPKLYEYVNCPNSSSHLVMLFKMPYHLPLCAK--KFPSDELARCPYNRTHMYPIADIYEHII 63
            |.:|.::    .||...:||:...:.||||..|.:  :..:.|||.||||..|..|..::..|:.
 Frog     1 MESDDRM----QCPYDKNHLIRPSRFPYHLVKCRENNRAAAKELATCPYNARHRVPKQELDLHMA 61

  Fly    64 KCPSYLREE------SHSDAKEDAKDCDAKESDAKDWDAD-PPVSTYDPNIHCEKNP 113
            .|...:..|      |:..|::....|...|   :.|:.| .|||...|.|..|..|
 Frog    62 SCEYRVAMEPLTADFSNMVAEKSTWQCPPCE---EVWETDEDPVSKPKPFILNEFAP 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32625NP_727732.1 zf-U11-48K 43..66 CDD:283028 8/22 (36%)
gtsf2NP_001120225.1 zf-U11-48K 7..30 CDD:283028 8/26 (31%)
zf-U11-48K 41..64 CDD:283028 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.