DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1789 and EDA14

DIOPT Version :9

Sequence 1:NP_572504.1 Gene:CG1789 / 31812 FlyBaseID:FBgn0030063 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_191595.1 Gene:EDA14 / 825207 AraportID:AT3G60360 Length:228 Species:Arabidopsis thaliana


Alignment Length:254 Identity:88/254 - (34%)
Similarity:134/254 - (52%) Gaps:43/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSWKNASKSNQKVHRERHQPESRQHLGFLEKKKDYKKRAIDAQKKQKTLKLLYRRAQNKNPDEF 65
            |||.:||..  :..|:||.|||:|:..|.|||.|||..||....|||:|||:|.::|..||||||
plant     1 MSSLRNAIP--RPAHKERSQPEARKRFGILEKHKDYIIRANAYHKKQETLKILRQKAAFKNPDEF 63

  Fly    66 YHHMINSKLSNDEHHEKDTKDEHTPEQLALMQTQDLKYVVMKRTMERKKIERLKASLVDVDAIKG 130
            ...|||||..:..|..||..::::.|:|.:|:|||:.||..|...|:.||::|.|||    ...|
plant    64 NFKMINSKTVDGRHRPKDEVNKYSAEELMIMKTQDIGYVFQKWQSEKNKIDKLTASL----QCTG 124

  Fly   131 --AANKRIKFDEDGYMELDMGEWLLKHDDEEEEEEKKKKS--KTTE-PNPIKQ---QRINELKKR 187
              ::.:.:.:.||            :.:..|.|.:.:.||  .|.| |..||:   :...:|:.|
plant   125 DQSSRRHVYYAED------------REEARELEVQGRSKSDISTVEIPKDIKKKMDRSYRDLEGR 177

  Fly   188 EQRERELG------IVQQKIQ---LKNTLKQPRLLKPRKIKPGTKDSAPVYKFRYERKK 237
            :.|.::|.      .:|:::|   .|..|:...||.|        :...|||:|.:||:
plant   178 KSRAKDLEKLYTDMSMQKELQKKGRKRKLRDDELLNP--------NGKAVYKWRADRKR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1789NP_572504.1 Utp11 12..237 CDD:281927 82/241 (34%)
EDA14NP_191595.1 Utp11 10..228 CDD:397895 82/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 114 1.000 Domainoid score I2027
eggNOG 1 0.900 - - E1_COG5223
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6349
Inparanoid 1 1.050 117 1.000 Inparanoid score I2011
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1346432at2759
OrthoFinder 1 1.000 - - FOG0004986
OrthoInspector 1 1.000 - - oto3622
orthoMCL 1 0.900 - - OOG6_102411
Panther 1 1.100 - - LDO PTHR12838
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4062
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.830

Return to query results.
Submit another query.