DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1789 and utp11

DIOPT Version :9

Sequence 1:NP_572504.1 Gene:CG1789 / 31812 FlyBaseID:FBgn0030063 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001165749.1 Gene:utp11 / 733999 XenbaseID:XB-GENE-992334 Length:253 Species:Xenopus tropicalis


Alignment Length:256 Identity:100/256 - (39%)
Similarity:147/256 - (57%) Gaps:25/256 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSWKNASKSNQKVHRERHQPESRQHLGFLEKKKDYKKRAIDAQKKQKTLKLLYRRAQNKNPDEFY 66
            ::::.|.||.|:.|:||.||..|::||.||||||||.||.|.:|||.||..|.::|.:|||||||
 Frog     3 AAFRKALKSRQREHKERSQPGFRRNLGLLEKKKDYKLRAEDHRKKQNTLNALRKKALDKNPDEFY 67

  Fly    67 HHMINSKLSNDEHHEKDTKDEHTPEQLALMQTQDLKYVVMKRTMERKKIERLKASLVDVDAIKGA 131
            :.|.:||..:..|..|...:|.|.||..||:|||:|||.|||..|.|||||||:.|..:|. :|:
 Frog    68 YKMTSSKQQDGVHIIKQKPEEVTDEQAKLMRTQDIKYVEMKRVAEAKKIERLKSELHLLDK-EGS 131

  Fly   132 ANKRIKFDEDGYMEL---DMGEWL---------LKHDDEEEEEEKKKKSKTTEPNPIKQ---QRI 181
            ......|..|...|:   |:...|         :.:....|...|:.......|..:||   :|.
 Frog   132 QRNTHTFFCDSKKEVLRFDLAAQLKTAPELVNRVYNRPTLETLHKESVKGVATPQQLKQLAKKRQ 196

  Fly   182 NE---LKKREQRERELGIVQQKIQLKNTL--KQPRLLKPRKIKPGTKDSAPVYKFRYERKK 237
            :|   ||:|.:|||::.::.||||.:..|  |:.::    |:|..|.:|..:|||:.:|::
 Frog   197 HEYDVLKQRIERERKMFVITQKIQARKDLLDKKEKV----KVKKETVNSPAIYKFKMQRQR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1789NP_572504.1 Utp11 12..237 CDD:281927 97/244 (40%)
utp11NP_001165749.1 Utp11 13..253 CDD:367763 97/244 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4637
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6349
Inparanoid 1 1.050 149 1.000 Inparanoid score I4289
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1346432at2759
OrthoFinder 1 1.000 - - FOG0004986
OrthoInspector 1 1.000 - - oto103067
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4062
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.