DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1789 and Utp11

DIOPT Version :9

Sequence 1:NP_572504.1 Gene:CG1789 / 31812 FlyBaseID:FBgn0030063 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_080307.1 Gene:Utp11 / 67205 MGIID:1914455 Length:253 Species:Mus musculus


Alignment Length:256 Identity:97/256 - (37%)
Similarity:146/256 - (57%) Gaps:25/256 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSWKNASKSNQKVHRERHQPESRQHLGFLEKKKDYKKRAIDAQKKQKTLKLLYRRAQNKNPDEFY 66
            ::::.|:|:.|:.||||.||..|:.||.||||||||.||.|..|||..|:.|.::|..|||||||
Mouse     3 AAFRKAAKTRQREHRERSQPGFRKRLGLLEKKKDYKLRANDYHKKQDFLRALRKKALEKNPDEFY 67

  Fly    67 HHMINSKLSNDEHHEKDTKDEHTPEQLALMQTQDLKYVVMKRTMERKKIERLKASLVDVDAIKGA 131
            :.|..:||.:..|..|:.|:|.|.|||.||:|||:||:.|||..|.|||||||:.|..:| .:|.
Mouse    68 YKMTRAKLQDGVHIFKENKEEVTAEQLKLMRTQDIKYIEMKRVAEAKKIERLKSELHLLD-FQGK 131

  Fly   132 ANKRIKFDEDGYMEL---DMGEWLLKHDDEEEEEEKKKKSKTTEPNPIK---------------Q 178
            ..|:..|..|...|:   |:...|....:..:....:.:.:|.:...:|               |
Mouse   132 QQKKHVFFFDTKKEVERFDVATHLQTAPELVDRVYNRPRIETLQKERVKGATPQTGLKRIAKERQ 196

  Fly   179 QRINELKKREQRERELGIVQQKIQLKNTL--KQPRLLKPRKIKPGTKDSAPVYKFRYERKK 237
            ::.:.|.:|.:||::|.:|.||||.:..|  |..::    |:|..|.:|..:|:|:..||:
Mouse   197 KQYDCLTQRIEREKQLFVVAQKIQTRKDLMDKTQKV----KVKKETVNSPAIYRFQTRRKR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1789NP_572504.1 Utp11 12..237 CDD:281927 94/244 (39%)
Utp11NP_080307.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 9/22 (41%)
Utp11 13..253 CDD:281927 94/244 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843176
Domainoid 1 1.000 146 1.000 Domainoid score I4534
eggNOG 1 0.900 - - E1_COG5223
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6349
Inparanoid 1 1.050 152 1.000 Inparanoid score I4335
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55307
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004986
OrthoInspector 1 1.000 - - oto92797
orthoMCL 1 0.900 - - OOG6_102411
Panther 1 1.100 - - LDO PTHR12838
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1614
SonicParanoid 1 1.000 - - X4062
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.