DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1789 and utp11

DIOPT Version :9

Sequence 1:NP_572504.1 Gene:CG1789 / 31812 FlyBaseID:FBgn0030063 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_956292.1 Gene:utp11 / 336149 ZFINID:ZDB-GENE-030131-8093 Length:250 Species:Danio rerio


Alignment Length:256 Identity:94/256 - (36%)
Similarity:140/256 - (54%) Gaps:25/256 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSWKNASKSNQKVHRERHQPESRQHLGFLEKKKDYKKRAIDAQKKQKTLKLLYRRAQNKNPDEF 65
            |||::.|.||.|:.|:||.|...|:|||.||||||||.||.|..:|:||:..|.::|.:||||||
Zfish     1 MSSFRKALKSKQRDHKERSQLGFRKHLGLLEKKKDYKLRADDYHRKEKTILALRKKAMDKNPDEF 65

  Fly    66 YHHMINSKLSNDEHHEKDTKDEHTPEQLALMQTQDLKYVVMKRTMERKKIERLKASLVDVDAIKG 130
            ...||:::|.:..|......:|.|.||..:|:|||::||.|||..|.|||||:|:.|..:|..| 
Zfish    66 NFKMIHNQLKDGVHMAIRKDEEMTEEQKKVMRTQDIRYVEMKRVSEMKKIERMKSELHFLDEKK- 129

  Fly   131 AANKRIKF--DEDGYMELDMGEWLLKHDDEEEEEEKKKKSKTTEPNPI----KQQRINEL--KKR 187
             .||.:.|  .:......|:...|....:..:....:...:|.|...|    |.:.|..|  |:.
Zfish   130 -KNKHVFFLDTKKEVKNFDLATHLNTVPELVDRAYNRPTIETLENKSIVGAMKAREIKSLAKKRN 193

  Fly   188 EQ---------RERELGIVQQKIQLKNTLKQPRLLKPRKIK--PGTKDSAPVYKFRYERKK 237
            ||         ||:::.::.||||.:..|:.    |.:|:|  ..|..:..:|||:.:||:
Zfish   194 EQYLRLSERIDREKKMFVISQKIQTRKDLQD----KVKKVKVCKETSTAPAIYKFQAKRKR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1789NP_572504.1 Utp11 12..237 CDD:281927 87/243 (36%)
utp11NP_956292.1 Utp11 12..250 CDD:281927 87/243 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588109
Domainoid 1 1.000 128 1.000 Domainoid score I5292
eggNOG 1 0.900 - - E1_COG5223
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6349
Inparanoid 1 1.050 138 1.000 Inparanoid score I4511
OMA 1 1.010 - - QHG55307
OrthoDB 1 1.010 - - D1346432at2759
OrthoFinder 1 1.000 - - FOG0004986
OrthoInspector 1 1.000 - - oto40514
orthoMCL 1 0.900 - - OOG6_102411
Panther 1 1.100 - - LDO PTHR12838
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1614
SonicParanoid 1 1.000 - - X4062
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.