DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1789 and Utp11

DIOPT Version :9

Sequence 1:NP_572504.1 Gene:CG1789 / 31812 FlyBaseID:FBgn0030063 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001101448.1 Gene:Utp11 / 313581 RGDID:621412 Length:253 Species:Rattus norvegicus


Alignment Length:255 Identity:100/255 - (39%)
Similarity:145/255 - (56%) Gaps:23/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSWKNASKSNQKVHRERHQPESRQHLGFLEKKKDYKKRAIDAQKKQKTLKLLYRRAQNKNPDEFY 66
            ::::.|:|:.|:.||||.||..|:.||.||||||||.||.|..|||..|:.|.::|..|||||||
  Rat     3 AAFRKAAKTRQREHRERSQPGFRKRLGLLEKKKDYKLRANDYHKKQDFLRALRKKALEKNPDEFY 67

  Fly    67 HHMINSKLSNDEHHEKDTKDEHTPEQLALMQTQDLKYVVMKRTMERKKIERLKASLVDVDAIKGA 131
            :.|..:||.:..|..||.|:|.|.|||.||:|||:||:.|||..|.|||||||:.|..:|.....
  Rat    68 YKMTRAKLQDGVHIFKDNKEEVTAEQLKLMRTQDIKYIEMKRVAEAKKIERLKSELHLLDVQGKQ 132

  Fly   132 ANKRIKFDE--------DGYMELDMGEWLLK--HDDEEEEEEKKKKSKTTEPN-------PIKQQ 179
            .||.:.|.:        |....|.....||.  ::....|..:|::.|...|.       ..:|:
  Rat   133 QNKHVFFFDTKKEVEQFDVATHLQTAPELLDRVYNRPRIETLQKERVKGVTPQTRLKRIAKERQK 197

  Fly   180 RINELKKREQRERELGIVQQKIQLKNTL--KQPRLLKPRKIKPGTKDSAPVYKFRYERKK 237
            :.:.|.:|.:||::|.:|.||||.:..|  |..::    |:|..|.:|..:|:|:..||:
  Rat   198 QYDCLTQRIEREKQLFVVAQKIQTRKDLMDKTQKV----KVKKETVNSPAIYRFQTRRKR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1789NP_572504.1 Utp11 12..237 CDD:281927 97/243 (40%)
Utp11NP_001101448.1 Utp11 13..253 CDD:281927 97/243 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346682
Domainoid 1 1.000 155 1.000 Domainoid score I4152
eggNOG 1 0.900 - - E1_COG5223
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6349
Inparanoid 1 1.050 161 1.000 Inparanoid score I4139
OMA 1 1.010 - - QHG55307
OrthoDB 1 1.010 - - D1346432at2759
OrthoFinder 1 1.000 - - FOG0004986
OrthoInspector 1 1.000 - - oto96353
orthoMCL 1 0.900 - - OOG6_102411
Panther 1 1.100 - - LDO PTHR12838
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4062
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.