DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1789 and C16C10.2

DIOPT Version :9

Sequence 1:NP_572504.1 Gene:CG1789 / 31812 FlyBaseID:FBgn0030063 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_497835.1 Gene:C16C10.2 / 175536 WormBaseID:WBGene00007623 Length:262 Species:Caenorhabditis elegans


Alignment Length:268 Identity:102/268 - (38%)
Similarity:148/268 - (55%) Gaps:37/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSWKNASK--SNQKVHRERHQPESRQHLGFLEKKKDYKKRAIDAQKKQKTLKLLYRRAQNKNPD 63
            |||..:.||  |.|:.||||.|||:|:..|.||||||||.||.|.|||:.|:|.|.:.|.:||.|
 Worm     1 MSSLVSISKKLSGQRQHRERSQPEARRKYGELEKKKDYKLRAEDYQKKRDTIKKLKKSAMDKNQD 65

  Fly    64 EFYHHMINSKL-SNDEHHEKDTKDEHTPEQL--ALMQTQDLKYVVMKRTMERKKIERLKASL--- 122
            |::|||:||:. ::..|.:|.|:.|.|..|:  .|...:||:||..|...|:|||:.:|..|   
 Worm    66 EYHHHMVNSETWADGRHFDKKTEAEETETQIQKKLGSLKDLEYVKFKLNEEKKKIDEMKGELHFA 130

  Fly   123 --------------VDVDAIKGAANKRIKFDEDGYMELDMGEWLLKHDDEEEE-------EEKKK 166
                          ||.|:...:.:.|:.||....| |......||::|.:.:       :|:.:
 Worm   131 DSSLNGKGNTHTVFVDTDSEAKSFDPRVYFDTTTSM-LSRQFNRLKNEDFQNKTIIGAGTKEQVR 194

  Fly   167 KSKTTEPNPIKQQRINELKKREQRERELGIVQQKIQLKNTLK--QPRLLKPRKIKPGTKDSAPVY 229
            |:     :.:::.|.|||.||.:|.:||.:|..|::||..|.  ....|||:|:|......|.||
 Worm   195 KA-----DRVRRTRYNELIKRVERAKELQVVVDKLELKKQLAAGSKSELKPQKVKKAKAMRAAVY 254

  Fly   230 KFRYERKK 237
            |:.|||||
 Worm   255 KWTYERKK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1789NP_572504.1 Utp11 12..237 CDD:281927 94/253 (37%)
C16C10.2NP_497835.1 Utp11 14..262 CDD:281927 94/253 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162744
Domainoid 1 1.000 143 1.000 Domainoid score I2900
eggNOG 1 0.900 - - E1_COG5223
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6349
Inparanoid 1 1.050 146 1.000 Inparanoid score I3023
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55307
OrthoDB 1 1.010 - - D1346432at2759
OrthoFinder 1 1.000 - - FOG0004986
OrthoInspector 1 1.000 - - oto18301
orthoMCL 1 0.900 - - OOG6_102411
Panther 1 1.100 - - LDO PTHR12838
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1614
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.