DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32603 and POU2AF1

DIOPT Version :9

Sequence 1:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_005271650.1 Gene:POU2AF1 / 5450 HGNCID:9211 Length:303 Species:Homo sapiens


Alignment Length:300 Identity:69/300 - (23%)
Similarity:101/300 - (33%) Gaps:75/300 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 STSYESYQAAPVEAAASETYVAPAAAASTYESESYSAPAASFTSESYAAPAAVEAAVETAAEETN 99
            ||....|:..|.....|.:.:..:.||....     .|.:..|..|..:||.  :.....|.|..
Human     2 STLQSHYEKHPPSYLLSWSQLQNSLAAGCGH-----VPGSQETRGSCGSPAT--SIGRATAPEQA 59

  Fly   100 EQPAASY--------VAPVVTKTTYSAPAVSSYSSYSAPAVVA--------KTYT--APAVVKTY 146
            ..||..|        |..::.:....|      ||.:|||..|        .|||  .|:.:...
Human    60 PAPARPYQGVRVKEPVKELLRRKRGHA------SSGAAPAPTAVVLPHQPLATYTTVGPSCLDME 118

  Fly   147 SAPAVSTYSAPAVSGYSQTYTAPAVVKTYSAPAVSTYTAPVVTKTYTAPVVAKTYTAPAVSTYTA 211
            .:.:..|..|...:|:....| ||.::.. || .:.||..|..:..:.|..|..|..|...:||.
Human   119 GSVSAVTEEAALCAGWLSQPT-PATLQPL-AP-WTPYTEYVPHEAVSCPYSADMYVQPVCPSYTV 180

  Fly   212 PVVAKTYTAPAVVKTYSAPAVSTYSAPAVSTYTAPVVTKTYTAPVVTKTYTAPAVVKTYSAPAVS 276
                   ..|:.|.||::|               |::|.     |.|::...|||......|   
Human   181 -------VGPSSVLTYASP---------------PLITN-----VTTRSSATPAVGPPLEGP--- 215

  Fly   277 TYTAPAVSTYTAPVVAKTYSAPAVSTYTAPVVTKTYSAPA 316
                    .:.||:   ||........|.|..|..|..||
Human   216 --------EHQAPL---TYFPWPQPLSTLPTSTLQYQPPA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 39/168 (23%)
rne <109..299 CDD:236766 45/199 (23%)
POU2AF1XP_005271650.1 PD-C2-AF1 54..302 CDD:286403 56/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15363
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.